SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004673 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004673
Domain Number 1 Region: 233-333
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-29
Family Phosphotyrosine-binding domain (PTB) 0.0000279
Further Details:      
 
Domain Number 2 Region: 81-200
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-18
Family Phosphotyrosine-binding domain (PTB) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004673   Gene: ENSEEUG00000005100   Transcript: ENSEEUT00000005117
Sequence length 1242
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1514:648322:652225:-1 gene:ENSEEUG00000005100 transcript:ENSEEUT00000005117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSSFARAPATRRLSTAAAARAAAPAAVVAAATTPLLLSGTSTALIGSGSSCPGAMWLS
TATGSRSDSESDEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKVEGADAPARLEYYENARQ
FRQNVRAAAAAAAAESGTAVARALIPPRRVIPLYQCFSVSQRADARYRHLIALFTPDEYF
ALVAESESEQESWYLQLCRLILESRRRRSGTPRALPGGSGAARASAVAELPFYHDVWQVV
VKSRGLGHRRELSGVFRLCLTDEEVVLVRLNTQVASVVIQLLSIRRCGHSERYFFLEVGR
SAAIGPGELWMQVDDCVVAQHMHELFLEKMRALCADAYRFRCRSYSISISAHLLTLLSAR
RHLDLLPLATGSWFRRSRFEQFYHLWPFGARSKDKFLSQLYKTPNEPVPHSRRVRIHLPR
GCRLRRAISMPPSYFRYLITSPVRDPQPAPQPAEATGDGAGPSNEASGSGSCNSGEEDKP
QDKEDQEGNKGDCVPMNNWGSGNGQGSGGGQGSTGQGSSSQGSGGNQCSGGGQGSGGGQS
SSGSQGSGGNQCSGQGTAGGHGSGGAQKSGGGRGSRRGQGHGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXARSLSLDATDTMEGDYLTSPAAT
PCFAARYDAEGRIYVVDSECCMDISLVPGRCAEPPPVARLLQEEEPERRRPQNRSRNSFA
STRAAVSAFPTDSLERDLSASLASAIPTLAVGWALAIASALAAAPGIGAAAAAGLEAAAG
IDSAALRWFRPVAYAADAGAQEVASGLNPRGENFSGDPALGENGVRGAAAAAPTPPAPPP
RRQLPRPPEGEDSEEDDDDDIYVRMDFARPDNKKFDSPKRGW
Download sequence
Identical sequences ENSEEUP00000004673 ENSEEUP00000004673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]