SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004744 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004744
Domain Number 1 Region: 12-183
Classification Level Classification E-value
Superfamily EF-hand 3.67e-40
Family Calmodulin-like 0.000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004744   Gene: ENSEEUG00000005218   Transcript: ENSEEUT00000005204
Sequence length 199
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_347015:33125:44539:-1 gene:ENSEEUG00000005218 transcript:ENSEEUT00000005204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQFSWEEAEATGEMDVAALQEWYKKFVVECPSGTLFMHEFKRFFKVTGNEEASQYVEG
MFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRLELLDIVEA
IYKLKKACRIETEGEQYQMLTPEVVDRIFLLVDENGDGRLSLNEFIEGARRDKWVMKMLQ
MDMNPGSWISQQRRKSAMF
Download sequence
Identical sequences ENSEEUP00000004744 ENSEEUP00000004744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]