SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004794 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004794
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily EF-hand 0.000000000111
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004794   Gene: ENSEEUG00000005277   Transcript: ENSEEUT00000005265
Sequence length 140
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7287:5369:70966:-1 gene:ENSEEUG00000005277 transcript:ENSEEUT00000005265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDQIEQLHRRFKQLSGDQPTIRKENFSSILLLNPIGAKIVRAXXXXXNLRRGPSGLAEE
INFEDFLGIMSYFRPMDTGLDEEQVELCRREKLRFLFHMDDSDSDSRIALEELNVKWWRS
CSRGTPTSRRSLPAPSPMGP
Download sequence
Identical sequences ENSEEUP00000004794 ENSEEUP00000004794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]