SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004809 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004809
Domain Number 1 Region: 522-602
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000565
Family Pleckstrin-homology domain (PH domain) 0.067
Further Details:      
 
Domain Number 2 Region: 60-231
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000672
Family HspBP1 domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004809   Gene: ENSEEUG00000005252   Transcript: ENSEEUT00000005284
Sequence length 701
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5498:3278:199438:-1 gene:ENSEEUG00000005252 transcript:ENSEEUT00000005284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKPLSAIIKEVCDGXXXXXXXXXXXXXXXXXXXXXXXXDRNEIKNGTILRLTTSPAQNAQ
QLHERVQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKI
MKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILE
SMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINALFLKAPDEKRQXXXXXX
XXXXXXXXXXXHVIRAQRAINNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXAYIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSETCNDFHPMFF
THDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMRALTTKPSSLDQFKSKL
QNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLN
SRRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMK
EKGALKQNKXXXXXXXXXXXXXXXXXXXXXXXXXXYCIWTDGLNALLGKDMMSDLTRNDL
DTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN
Download sequence
Identical sequences ENSEEUP00000004809 ENSEEUP00000004809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]