SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004811 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004811
Domain Number 1 Region: 181-264
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000023
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 78-139
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000253
Family PDZ domain 0.006
Further Details:      
 
Domain Number 3 Region: 284-389
Classification Level Classification E-value
Superfamily PH domain-like 0.000000179
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004811   Gene: ENSEEUG00000005265   Transcript: ENSEEUT00000005287
Sequence length 517
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4958:13406:157699:1 gene:ENSEEUG00000005265 transcript:ENSEEUT00000005287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGXXXXXX
XXXXXXXXXXXXXGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQLHNVNVRKCXXXX
XVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYLPGTDLSRQNAFQVIAVDGVC
SGIIQCLSAEDCADWLQAIATNISNLTKHNXXXXXXXXXXXXXIVYMGWCEVREQDPLQD
RVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDRRKHCFTV
QSESGEDLYFSVELDCDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAVLWRYKFSQLTGSSDDGKSKIKFLFQNPDPKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLFLGNQATTSAAASSATTSKTKYTT
Download sequence
Identical sequences ENSEEUP00000004811 ENSEEUP00000004811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]