SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004893 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004893
Domain Number 1 Region: 225-548
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-88
Family Protein kinases, catalytic subunit 0.0000000883
Further Details:      
 
Domain Number 2 Region: 1-70
Classification Level Classification E-value
Superfamily CAD & PB1 domains 8.24e-18
Family PB1 domain 0.00014
Further Details:      
 
Domain Number 3 Region: 117-158
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004893   Gene: ENSEEUG00000005346   Transcript: ENSEEUT00000005376
Sequence length 567
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7774:234:126144:1 gene:ENSEEUG00000005346 transcript:ENSEEUT00000005376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DILITSLDPTTTFEELCAEVRDMCRLHEGHPLTLKWVDNEGDPCTVSSQMELEEAFRLAF
QRRDEGLIIHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAYC
GQCSERIWGLARQGYRCINCKLLVHKRCHVLVPLTCRRHMDSVMPSQEPPVDDKNDGVDL
ASEETDGIAFISSSRKHDIKDDSEDLKPVIEGMDGIKISQGLGLQDFDLIRVIGRGSYAK
VLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSR
LFLVIEYVNGGDLMFHMQKQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLD
ADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMM
TGRSPFAIITDNPDMNTENYLFPVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRP
QTGFSDIKSHAFFRSIDWDLLEKKLALPPFQPQITDDYGLNNFDTQFTSEPVQLTPDDED
VIKRIDQSEFEGFEYINPLLLSTEESV
Download sequence
Identical sequences ENSEEUP00000004893 ENSEEUP00000004893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]