SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004934 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004934
Domain Number 1 Region: 316-500
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.1e-49
Family Oxysterol-binding protein 0.0057
Further Details:      
 
Domain Number 2 Region: 570-685
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 6.15e-24
Family Oxysterol-binding protein 0.011
Further Details:      
 
Domain Number 3 Region: 6-69
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000402
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004934   Gene: ENSEEUG00000005403   Transcript: ENSEEUT00000005422
Sequence length 685
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2137:7625:31355:-1 gene:ENSEEUG00000005403 transcript:ENSEEUT00000005422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKA
KAVKMLAESDESGDEESVSQTDKTELQNTLRTSSKVEDLSTCNDLIAKHGTALQRSLSEL
ESLLLPAESTEKIKQVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVS
SYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQE
IKITSKFRGKYLSIMPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGEIDIVN
HKTGDKCNLKFVPYSYFSRDVARKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQR
LMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTPYDPYKALWFERKKDPVTKE
LTHIYRGGYWESKEKQDWNSCPDIF
Download sequence
Identical sequences ENSEEUP00000004934 ENSEEUP00000004934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]