SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005024 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005024
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily PX domain 3.16e-24
Family PX domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005024   Gene: ENSEEUG00000005540   Transcript: ENSEEUT00000005516
Sequence length 169
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_534:68:53966:1 gene:ENSEEUG00000005540 transcript:ENSEEUT00000005516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVYIPSFRYEESDLERGYTVFKIEVFMNGRKHFVEKRYSEFHALHKKLKKCIKTPEMPS
KHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDET
ESEESSKLSHQPVLLFLRDPYVLPAASDCPNVVIEGVLHGIFYPHLQPR
Download sequence
Identical sequences A0A1S3A0Z3
ENSEEUP00000005024 XP_007527659.1.11023 ENSEEUP00000005024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]