SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005138 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005138
Domain Number 1 Region: 500-680
Classification Level Classification E-value
Superfamily PH domain-like 7.77e-25
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 694-810
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000115
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005138
Domain Number - Region: 1199-1233
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000733
Family Second domain of FERM 0.016
Further Details:      
 
Domain Number - Region: 1002-1078
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00284
Family Ubiquitin-related 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005138   Gene: ENSEEUG00000005536   Transcript: ENSEEUT00000005641
Sequence length 1370
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5284:3368:44329:1 gene:ENSEEUG00000005536 transcript:ENSEEUT00000005641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQLEKEVLEAERRAQRAEWQVQVMEEKLKAANIQTSEAETRLYRKCQDLEALVQEKDDL
IHSLGLQLEEQKQLRQEAKIIEEKAKIKEWVTVKLNELELENQNLRLINQNQTEELGAMQ
LRLPETEGMKCPAASVPKAPEDQRLSSLMSGCFSPQARSPPRAVRLAEASKASSEDSELS
GRREQEAEVPEISMGEQRPEASGSLRTGPVMSCISAEKGTARSSHDPKGGIPLSGPPASD
WSSEDEGSRGRSLSRHTSTLSSQTSEEGARGSDPYLTASDDNSSVCDEDAGRGKRLGQRW
LLCWQREAQRWAQGGCAGPGRWPAGTSGQWRGRPWDPAPDGSSSSSEAASPSPSLTYRQP
GPLSGGVPPLGLPAGLARRPLSQPQPCCDRASSAHRNALSMIRPLRPQETDLDLLDVASR
DCQDPAPEQDQGHACGQPPTPPLHRFPSWESRIYAVARSGMRMSGALTLDSTSSGPTVLP
PEGTTGPYMAFIYRDVTAPVYTTLKGKATQVSCSPSLDESSGSEEEGGSRRSSCTSGPHP
GVSLSSVASDGDYAIPPDAYGTDPEPSQPEQRPQRGCPTPCDGNRQEPLEKSGYLLKRGA
RAQAWRRRWFILKGAELLYYKSPSDVTRKPQGHIELTAACSLLRGDKQTVQLTTEKQTLC
LGADSPNLLEDWIRALKRALCAQAHGLLSLPAVGKPAVQGQLTKVKHGYSKSVWCALIGK
TLYYFRSQEDKFPLGQIKLWEAKVEEVDRSCDSDDDYAASNQGLLSPRYTGGMHPPGQGP
TYLLLSSRPEKDTWLYHLTVAAGGNSDNVGSEFEQLVCKLLSIEGEPASQIWRHPALCHS
KEGILSPLTTLPSQALRTEAIKLFKTCQLFINAAVDAPAIDYHVSLAQSALQVCLTHREL
QSELCCQLIKQTRRRQPHSQPGPLQGWQLLALCVGLFLPSHPFLWLLRLHLRRNADTRTE
FGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSVPVHFLNGLYQVVG
FDASTTVEEFLNTLNQEAGMRKPSQSGFALFTDDPAGHDTEHCLQGNIKICDIISKWEQV
SKEQPPEKWEGTRTVRLTYKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQL
SQRLAARWQALRGHSSTDCARIYLTVARKWPFFGAKLFLAQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXRPVVSHSYKSLMTFGGCRDDFMIVISSAHPKDKPPEKLLFAMAKPKVLEI
TLLMASYINSALQQRALHHLSAPALLSAQERGAWTLPLGTQLPPLRTGPT
Download sequence
Identical sequences ENSEEUP00000005138 ENSEEUP00000005138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]