SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005224 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005224
Domain Number 1 Region: 600-702
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.07e-25
Family Ypt/Rab-GAP domain of gyp1p 0.0022
Further Details:      
 
Domain Number 2 Region: 24-135
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-19
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005224   Gene: ENSEEUG00000005723   Transcript: ENSEEUT00000005734
Sequence length 900
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1237:4149:159328:-1 gene:ENSEEUG00000005723 transcript:ENSEEUT00000005734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTRDNPAAPGSAGASPPEDAEGPPRPLEAAPTKLCGYLSKFGGKGPLRGWKSRWFCYD
EKKCHLYYSRTAQDANPLDSIDLACAALECKADAEEGTFEIKTPSRVITLKAADKQVMLY
WLQQLQMRRWEFHSSPPAPPEAALTGNGPALRLELXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGEPQREEQPSPH
DASTPGKDPADMLKSIPKSSLTNRLTQKDKRHNNTFPFFPDGLMRSRTAQEKVLSLEQQV
LTLSKELQSQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
CAYLQARNCQVESKYLAGLRRLQEAMGPGAGECSELLRQLVQEALQWEAGEAAADSVQLS
PISEYDEYGFLTVPDYDMADLKLLAKIQALEVHSRNLLDQEAGERPLRERWTALEELSPS
AELKQLLRAGVPPEQRPRVWRWLVRHRVQRLYSPDRYQELLARGLTCEHPAARQIELDLH
RTFPNNKHFTCPTSTFPDKLRRVLLAFSWQNPTIGYCQGLNXXXXXXXXXXXXXXXXXXX
XVAIVKTILPADYYSKTLTAPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLTSIA
FSDMNPFSMKQLRQLRAVHRERLEAELRELERFKAEYLETRVCQGPAVPEGCASEDEGEA
Download sequence
Identical sequences ENSEEUP00000005224 ENSEEUP00000005224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]