SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005236 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005236
Domain Number 1 Region: 293-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-74
Family Protein kinases, catalytic subunit 0.000000000478
Further Details:      
 
Domain Number 2 Region: 124-245
Classification Level Classification E-value
Superfamily SH2 domain 3.6e-36
Family SH2 domain 0.00000205
Further Details:      
 
Domain Number 3 Region: 77-148
Classification Level Classification E-value
Superfamily SH3-domain 4.44e-16
Family SH3-domain 0.0000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005236   Gene: ENSEEUG00000005742   Transcript: ENSEEUT00000005747
Sequence length 539
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8360:16396:41249:1 gene:ENSEEUG00000005742 transcript:ENSEEUT00000005747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSNKSKPKDASQRRRSLEPPENTHSTSGGAFPTSQTPSKPASADGHRTAFTPAAAEPKL
FGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKRERLQIVNNTRKVDVR
EGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLV
RESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHA
DGLCHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTWNGTTRVAI
KTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGET
GKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDN
EYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQ
VERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Download sequence
Identical sequences ENSEEUP00000005236 ENSEEUP00000005236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]