SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005272 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005272
Domain Number 1 Region: 1-157,187-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.64e-65
Family BAR domain 0.00062
Further Details:      
 
Domain Number 2 Region: 241-273,304-361
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-18
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005272   Gene: ENSEEUG00000005786   Transcript: ENSEEUT00000005784
Sequence length 362
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_365318:56925:92694:-1 gene:ENSEEUG00000005786 transcript:ENSEEUT00000005784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTEEKLGQAEKTELDAHLENLLGKAECTKTWTEKIMKQTEVLLQPNPNARIEELVYEKLD
RKLPSRVNNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFL
TPLRNFIEGDYKTIAKEKKLLQNKRLDLDAAKTRLKKAKTADTRASQLNSARLEGDNIMI
WAEEVTKSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQ
YMLDLQKQLGSFPSSYHSNNSQTPVAPVPSASSSVVVSSPLTSTSGLALSSPSSITDLKE
SSGSRKARVLYDYDAANSSELSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITYLEL
LN
Download sequence
Identical sequences ENSEEUP00000005272 ENSEEUP00000005272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]