SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005351 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005351
Domain Number 1 Region: 16-90
Classification Level Classification E-value
Superfamily EF-hand 0.0000000232
Family S100 proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005351   Gene: ENSEEUG00000005903   Transcript: ENSEEUT00000005872
Sequence length 104
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8231:3898:4953:-1 gene:ENSEEUG00000005903 transcript:ENSEEUT00000005872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQCQSANAEDAQEFSDVEKAIETLIQNFHQYAVEGSKEALTSSELHNLITQQLSHLMPS
TCGLEEKIAHLGGCGDSRVEFGTFWELIGEAAKNVKMETPGRGS
Download sequence
Identical sequences A0A1S2ZVZ8
XP_007525449.1.11023 ENSEEUP00000005351 ENSEEUP00000005351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]