SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005359 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005359
Domain Number 1 Region: 312-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.61e-25
Family Clostridium neurotoxins, the second last domain 0.034
Further Details:      
 
Domain Number 2 Region: 121-227
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-16
Family Cadherin 0.0041
Further Details:      
 
Domain Number 3 Region: 9-133
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000006
Family Cadherin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005359   Gene: ENSEEUG00000005860   Transcript: ENSEEUT00000005882
Sequence length 950
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7012:2298:33482:-1 gene:ENSEEUG00000005860 transcript:ENSEEUT00000005882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKHKPWLEHTYHGIVTENDSTVLLDPPLIALDKDAPLPFSESFEVTVTKEGEICGFKIHG
QNVPFDAVVVDKSTGEGMIRSKEKLDCELQKDYTFTIQAYDCGKEPDGTSVKKSHKATVH
IQVSDVNEYAPVFKEKSYKATVVEGRQYDSILRVEAMDADCSPQFSQICSYEIVTPDVPF
AIDKDGSIRNTEKLNYEKEHQYKLTVTAYDCGKRRAPEDVLVKISIQPTCSPGWQGWSSR
VEYEPGTGALPLFPNIHLETCEEPVASVRATVELETGHIGKGCDRDTYSEKSLHRLCGAA
PGTAELLPPPSSSSNWTAGLPTDNGHDSDQVFEFNGTQAVRIPDGVVSVSPKEPFTVSVW
IRHGPFGRKKETVLCSSDKTEMNRHHYSLYVHGCRLVFLLRQDPSEEKKYKAAEFHWKLN
QVCDEKWHHYVLNVEFPSVTLYVDGTSHEPFSVAEDYPLHPSRIETELVVGACWQEYSGV
GNDSETEPVPVASAGGDLHMTQFFRGNLAGLTIRSGKLADKKVIDCLYTCKEGLDLQVPE
DSGHSVKIQADPSQSALTLEGEDIGELEKAMQHLSYLNSRQFPTPGIRRLKITSTVKCFN
EAACISAPPLDSCVVVLQPEEPRISLSGIHHFARAASEFESAEGVFLFPELRAISTVTRA
VGPEGDGDEDPTVQESLVSEEVVHDLDSCEVTVEGEELNPEQESLEVDMARLQQKGIEVS
SSHLGMTLTGVGTMASYEEALHLLRYRNWHTRSLLDRKFKLTCSELNGRYVSNEFQVEVN
VLHTARPVEHASHMAAQPQFVHPEHRAFVDLSGHNLASPHPFAVVPSTATVVIVVCVSFL
VFMIILGVFRIRAAHQRTMRDHDSGKENEMDWDDSALTITVNPMETYEDQHSSEEEEEED
DEEEESEDGEEEDDVTSAESESSEEEGGHRARQRGSQPQQLEWDDSTLSY
Download sequence
Identical sequences ENSEEUP00000005359 ENSEEUP00000005359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]