SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005405 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005405
Domain Number 1 Region: 3-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.75e-51
Family Ankyrin repeat 0.0000835
Further Details:      
 
Domain Number 2 Region: 762-833
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.16e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 837-899
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.25e-16
Family SAM (sterile alpha motif) domain 0.0031
Further Details:      
 
Domain Number 4 Region: 1021-1123
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000038
Family Phosphotyrosine-binding domain (PTB) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005405   Gene: ENSEEUG00000005895   Transcript: ENSEEUT00000005928
Sequence length 1124
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7907:3126:345466:-1 gene:ENSEEUG00000005895 transcript:ENSEEUT00000005928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWRGPNVNCTDSSGYTALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDV
EIVKILIHHGPSHSRVNEQNNENETALHCAAQYGHSEVVAVLLEELTDPAIRNSKLETPL
DLAALYGRLRVVKMIVSAHPHLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTE
KGSALHEAALFGXXXXXXXXXXXXIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQEYL
EGLGRSTVLEEHAQEDTAQETNNSSSPVASPLQKTKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTSSTINLSPGEVEDDYDNENTCGPTGL
WEALTPCNGCRNLGFTMLAQESYPKKRNYTMEMVPSASVDTFPSENENFLCDLTDTAVTK
KPCSLEIARAPSPRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPKQRTSIVSALDFQRMNHSQEYFEIVTATECAALTPSPPASPPTSSVGTTGVKDEGTGH
TDDLPQPEDTDPPREYDPGQFAGLLHGSSPACESPENPFHLYGKRDEPGEVQEEMNLASN
PLTFKQPPAGKNSEPLVKKVKPKVVSRTIFHKKSSHLQNHTIVGTKASRSGSRSGEQWMA
TTGTFVERACTLGRIRSLPKALIDMHLSKNVSKSDSDLIGYPSTEKAARVNWSETSTAEH
SSRGNSERTPSFTSEWEEIDKIMNSIDIGINSELEEMDGENTRPRCPVQTVGQWLESIGL
PQYENHLMANGFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHEGY
HPTSVAEWLDSIELGDYTKAFLINGYTSMDLLKKIWEVELINVLKISLIGHRKRILASLG
DRLQEDPPQKPPRSITLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XYLGSMLIKELRGTESTQDACAKMRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNI
IAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDV
Download sequence
Identical sequences ENSEEUP00000005405 ENSEEUP00000005405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]