SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005488 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005488
Domain Number 1 Region: 141-364
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-42
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 940-1026
Classification Level Classification E-value
Superfamily Ras GEF 4.05e-29
Family Ras GEF 0.001
Further Details:      
 
Domain Number 3 Region: 352-507
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000218
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 4 Region: 730-797
Classification Level Classification E-value
Superfamily Ras GEF 0.00000183
Family Ras GEF 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005488
Domain Number - Region: 11-74
Classification Level Classification E-value
Superfamily PH domain-like 0.000509
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005488   Gene: ENSEEUG00000005963   Transcript: ENSEEUT00000006019
Sequence length 1027
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2382:3:169713:1 gene:ENSEEUG00000005963 transcript:ENSEEUT00000006019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPGGARDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVL
MQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDED
PDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLY
ILVNGFLRPLRMAASSKKPPISHDDVSSIFLNRETIMFLHEIFHLGLKARIANWPTLILA
DLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTY
PMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRIMHDEVSDTENIRKNLAIE
RMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFL
ICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASEDDSKGSGHVFGHLDFKIVVEPPDAAP
FTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVFEENSKVSVPHMIXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGLLSPEQIPGSVEHIDPRVNLCNKREQSILRAVPESAAVDRAAVVGS
VPSDTSELSPCRSPSTPRHLRYRQAGGQTADNSHCSVSPASAFAIATAAAGHGNPPGFNN
TERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQ
ERKATANILRVLSQDDQDDIYLKLEDIIQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTALMDKLQKTVSSGGRFKNLR
ETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSY
RIDHQPK
Download sequence
Identical sequences ENSEEUP00000005488 ENSEEUP00000005488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]