SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005513 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005513
Domain Number 1 Region: 224-367
Classification Level Classification E-value
Superfamily PH domain-like 1.95e-36
Family Pleckstrin-homology domain (PH domain) 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005513   Gene: ENSEEUG00000006049   Transcript: ENSEEUT00000006044
Sequence length 387
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1877:28392:41683:-1 gene:ENSEEUG00000006049 transcript:ENSEEUT00000006044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEDLSLEEREELLDIRRRKKELIDDIERLKCEIAEVMTEIDSLTSVEESKTTQRNKQVAM
GRKKFNMDPKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEFNIKVLQ
GFLELHEFADLHPVPALPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLYESIKNEPFKIPE
DDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLEN
LSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHIVYRISAPSPEEKEEWM
ESIRASISRDPFYDMLATRKRRVANKK
Download sequence
Identical sequences ENSEEUP00000005513 ENSEEUP00000005513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]