SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005575 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005575
Domain Number 1 Region: 2043-2182
Classification Level Classification E-value
Superfamily BEACH domain 3.79e-52
Family BEACH domain 0.00000401
Further Details:      
 
Domain Number 2 Region: 2438-2578,2668-2707
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.51e-24
Family WD40-repeat 0.0055
Further Details:      
 
Domain Number 3 Region: 1941-2001
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000602
Family PreBEACH PH-like domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005575   Gene: ENSEEUG00000005868   Transcript: ENSEEUT00000006109
Sequence length 2715
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5795:5006:44235:1 gene:ENSEEUG00000005868 transcript:ENSEEUT00000006109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REPGRAMAASERLCELWLLYYKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSLQDAERLPPAVLLRLIHVFGAVLAGGKENGQRAVSAGAVQGLLGVVR
GWGCRPAVDSARDRRVLPLALEALVGAVHVLHASRAPPRGPELRALLEGYFRVLNTDWPA
GPSPGPEEALVALRVSMLEAIPMMLACEDRPVLQATFLSNNCFEHLMRLVQNSKXXXXXX
XXXXXXXXXXXXXXXXXXXXXVLDQDADAIAVHVVRVLTCIMNGSPSAKEVFKERIGYAH
LHEVLQSHGPPTHRLLQELLNMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCTRREYLTVSLPEVPFADSAWHCVAVVHMPGRRPFSQSLVHIYKDGSLLKTAPL
RCPSLGEPFSSCCIGSAGHRTTTTTTGLPAPPGAAALAHSHPSLTRSQSVPATAGLGWGS
GLMAPLEEGSISSTLAGTQDTRWGSPTSLEGELGAVAIFHEALQPAALRALCTMXXXXXX
XXXXXXXXXXXXXXXXXXXXXXACKNNICLDLSPSHGLDGRLTGHRVETWDVKDVVNCVG
GMAALLPLLERVATQPQEAEAGPAETHDLVGPELTSGHSAQGLVLPLGKSSEERMERNTV
AAFLLMLKNFVQGHTVNQESLVQCQGPAIIGALLRKVPPWAMDMNVLMSAQLLMEQVAVE
GGGPLLYLLYQHLLFNFPLWTLSDFAVRLGHIQYISSIVREHRQRLRKRYGVQFILDALR
MHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSPLCPPGTPS
QESAPPPSEPEPSDVLPSEGPCPDPDAVYQALSPFCTPFDLGLERASVGSGNTAGCGSGT
LTPASQPSTPSPLDGPRPFPAAPGRHSSSLSNVLEDGSLPEPAVGGDDASNNSNPQQTCE
EELCNLLTNVLFSVTWRGVEGTDEAAWRERGQVFSVLTQLGASATLVRPPDYIKRSLLEM
MLESALTDIREAHTGGLAGLGQQALWLLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHLIMSFGEDSHARGHDLMSVF
NACYDTLISGGQQRQRALSRRALQELVLEPVQHRARLEGLRYGSALKQQAAQHATALLHW
GVLWRQLSSPCGAWALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXQHVYFYDGSAERVETEEGIGHDFRRPLAQLREVHLRRFNL
RRSALELFFIDQANYFLNFPSRARGTPASSPAPRPQPCPSPPHTQVRNQVYSWLLRLHPH
CQGYLSSRSPQDMLRASGLTQKWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLQD
YVSPILDLSNPAVFRDLSKPIGVVNPKHAQLVREKYESFEDPAGTIDKFHYGTHYSNAAG
VMHYLIRVEPFTSLHVQLQSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVISDGVPVVLALVPHRQSHSFISQSSP
DLLVTVSASGLLGTHSWLPYDRNINNYFSFSKDPNMGSPKTQRLLSGPWVPGSDVNGRAL
AVAPDGKLLFSGGHWDGSLRVTSLPRGKLLSQLRHHLDVVTCLALDTCGIYLISGSRDTT
CMVWQLLQQGGLSVGLATKPVQVLYGHEAAVSCVAISTELDMAVSGSEDGTVIIHTVLDG
QFGAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPAAPPLPMKVPIRSVAVTKERSHVLVGL
EDGKLIVVGSGRPSE
Download sequence
Identical sequences ENSEEUP00000005575 ENSEEUP00000005575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]