SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005583 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005583
Domain Number 1 Region: 613-717
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-29
Family Cadherin 0.0005
Further Details:      
 
Domain Number 2 Region: 508-620
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-28
Family Cadherin 0.00043
Further Details:      
 
Domain Number 3 Region: 926-1036
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-26
Family Cadherin 0.00099
Further Details:      
 
Domain Number 4 Region: 815-930
Classification Level Classification E-value
Superfamily Cadherin-like 2e-25
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 402-506
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 297-400
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 1030-1130
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.00083
Further Details:      
 
Domain Number 8 Region: 1708-1917
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-20
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 9 Region: 719-819
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-18
Family Cadherin 0.00084
Further Details:      
 
Domain Number 10 Region: 1632-1691
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000317
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 11 Region: 1132-1219
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000585
Family Cadherin 0.01
Further Details:      
 
Domain Number 12 Region: 1951-1997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000356
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1404-1435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005583
Domain Number - Region: 1915-1949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000107
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 2045-2084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number - Region: 2073-2147
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00133
Family Hormone receptor domain 0.0056
Further Details:      
 
Domain Number - Region: 1384-1408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00894
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005583   Gene: ENSEEUG00000005891   Transcript: ENSEEUT00000006117
Sequence length 4043
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7767:5752:51819:-1 gene:ENSEEUG00000005891 transcript:ENSEEUT00000006117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPHGTASTSPGHAHSLQIFRLKSGAGLGTSSVERRTRGPQKAGRRSQHSALGSREELGGG
GGQEWDPDPGVAAATVPGVPVGSRVSALCPEPSGVREDGDPALVELRGGRPCSRGDSGPS
EQLDARLRTEHGVRARGAQPPGSVLCWRPEVPACRRAGPLREGSLSPQALSPGVLGPENR
SPSPSDLLLPASKPVSSPRSVGRSAPKVGTARCRGAQKEKTKTFRGDAGPGCGPGSAPRT
ARTAPAPVSAPRAARTAPGPPPERTRARRRRFLPGVPAPPQIPGAGRLRPGRAANRHPQF
PQYNYQALVPENEAAGTSVLRVVAQDPDAGEAGRLVYSLAALMNSRSLELFSIDPHSGLI
RTEAALDRESLERHYLRVTAQDLGSPRLSATTMVAVTVADRNDHSPVFEQAQYRETLREN
VEEGYPILQLRATDGDAPPNANLRYRFVGAPAAAFEIDPRSGLISTSGRVDREHMESYEL
VVEASDQGREPGPRSATVRVHITVLDENDNSPQFSEKRYVAQVREDVRPHTVVLRVTATD
QDKDANGLVHYNIISGNSRGHFAIDSLTGEIQVVAPLDFEAEREYALRIRAQDAGRPPLS
NNTGLASIQVVDINDHAPIFVSTPFQISVLENAPLGHSVIHIQAVDADHGENARLEYSLT
GVAPDTPFVINSATGWVSVSGPLDRESVEHYFFGVEARDHGSPPLSASASVTVTVLDVND
NRPEFTMKEYHLRLNEDAVVGTSVVSVTAVDRDANSAISYQITGGNTRNRFAISTQGGVG
LVTLALPLDFKQERYFTLAPTASDRALHDHCYVHVNITDANTHRPVFQSAHYSVNVNEDR
PVGSTVVVISASDDDVGENARITYLLEDNLPHFRIDADSGAITLHAPLDYEDQVTYTLAI
TARDNGIPQKEDTTYVEIMVNDVINDAPQFVASHYTGLVSEDAPPFISVMQISATDRDAH
ANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYAVDRGMPPLRTPV
SIQVTVQDVNDNAPIFPAEEFEVQVKENSIVGSVVAQITAVDPDEGPNAHIMYQIVEGNI
PELFQMDIFSGELTALIDLDYETRQEYVIVVQATSATLVSRATVHVRLIDQNDNSPVLNN
FQILFNNYVSNHSDTFPSGVIGRIPAYDPDVSDQLFYSFERGNELQLLVVNQTSGELRLS
RKLDNNRPLVASMLVTVTXXXXXXXXXXXXXXXXXXXXLLANSLTVRLENMWQERFLSPL
LGHFLEGVAAVLATPTEDVFIFNIQNDTDVGGTVLNVSFSALAPRGAGAGSAGPWFSSEE
LQEQLYVRRAALAARSLLDVLPFDDNVCLREPCENYMKCVSVLRFDSSAHFLTSASTLFR
PIQPIAGLRCRCPPGFTGDFCETELNLCYSNPCRNGGACAQREGGYTCACRPRFTXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXSLDLTGPLLLGGVPNLPENFPVTHKDFTGCMRDLHIDGRRVDMAAFVA
NNGTTAGCQAKLHFCESHPCQNNGVCSERWGGFSCDCPVGFGGQDCRLTMTHPHHFWGNG
SLSWDFGNDVTVSAPWYLGLAFRTRATQGVLMQVQIGPHSTVLCQLDLGLLSVTVTRDLG
RAAHLLLDQVTVSDGRWHDLRLELQEEPGGRRGHHVLMVSLDFSLFQDTVAVGNELQGLK
VEQLHVGGLPHSSEESPQGLVGCIQGVWLGSTPSGSPALLPPSHRVNVEPGCVVTNACAS
GPCPPHADCQDHWLTFSCTCRPGYYGPGCVDACLLNPCQNQGSCRHLPGAPHGYTCDCAG
GYFGHRCEHRMDQQCPRGWWGSPTCGPCNCDVHKGFDPNCNKTSGQCRCKEFYYRPRGSD
SCLPCDCYPVGSTSRSCAPHSGQCPCRPGALGRQCNSCDSPFAEVTASGCRVLYDACPKS
LRSGVWWPQTKFGILASVPCPRGALGVAVRLCDEEQGWLEPDLFNCTSPAFEELNLQLDG
LELNKTTLDTVEAKKLAQRLREVTGRTKHYFSQDIRVTARLLAHLLAFESHQQGFGLTAT
QDAHFNENLLWAGSALLAPDTRDLWAALGQRAPGGSPGSAGLVQHLEEYAATLARNMEHT
YLNPVGLVTPNIMLSIDRMEHPSPTRGTRRYPRYHSNLFRGQDAWDPHTHVLLPSQSPRL
SPPDVVPTSSSNTENATSSVAPTPAPAEPEPEPGVSVVILLVYRTLGGLLPAQFQAERRG
ARLPQNPVMNSPVVSVAVFRGRSSLRGVLESPISLEFRLLQTANRSKAICVQWDPPGPVD
QHGLWTARDCELVHRNGSHARCRCSRTGTFGVLMDASPRERLEGDLELLAVFTHVMVAVS
VAVLLLTAAVLLSLRSLKSNMRGIHANVAAALGVAELLFLLGIHRTQRQVQDQGWXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMQVEPRNIDRGAMR
FYHALGWGVLAVLLGLAVGLDPEGYGNPDFCWISVHEPLIWSFAGPVVLVIVXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XGLAVLLLFCVLNADARAAWTPACLGRKAVPEEARPSAPGTGPGAYNNTALFEESGLIRI
TLGASTVSSVSSARSGRTQDQDSQRGRGYLRDNVLVRHGSAADHTDHSLQAHTGPTDLDV
AMFHRDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLRRAAQSERLLAHPK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDQVSSIHPSTEQL
DILSSILASFNSSALSYSVQSSSTPSGPHTTATLSATASALGPSTPRSATSHSISELSPD
SXXXXXXXXXXXXXXXXXXXXXXXXXXPLLDQEQLEELGHCGSATRTLQWRTWFRCSGAR
ARALVLHFLPVLAWLPRYPVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPAVYGLYSS
FYPVFIYFLFGTSRHISVGGPEPRATGTFAVMSVMVGSVTESLVLNGNSTDNEAVQLAST
LSVLVGLFQVALGLVHFGFIVTYLSEPLVRGYTTAASVQVLVSQLKYVFGLTLSSRSGPL
SLIYTVLEVCWSLPNANVGTVVTAAVAAVVLVLMKLLNDKLQRQLPIPIPGELLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXELVTLGLSNFVGGFFQCFISCSMSRSLVQESTGCNTQVAGAVSSLVIL
VIILKLEQLFQHLPKAVLAAVIIVNLKGMMKQFTDICFLWKANRMDLAIWLVTFVATILL
NLDLGLAAALAFSLMLVVVRTQLPHYSVLGQVPDTDIYRDVEEYSEAKEVPGVKVFRSSA
TVYFANAELYSDTLRQKCGVDVDSLLSQKKKLLKKQELKLKRLQKEEKQLQEQAGPPQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHDAVVFALQHPR
TSLASPVLVSSVCEQVGSELLLW
Download sequence
Identical sequences ENSEEUP00000005583 ENSEEUP00000005583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]