SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005607 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005607
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily EF-hand 1.74e-39
Family Calmodulin-like 0.00000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005607   Gene: ENSEEUG00000006181   Transcript: ENSEEUT00000006142
Sequence length 126
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5969:37017:46581:1 gene:ENSEEUG00000006181 transcript:ENSEEUT00000006142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGD
ASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVE
MLEIIE
Download sequence
Identical sequences A0A087V7R2
ENSEEUP00000005607 ENSEEUP00000005607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]