SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005613 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005613
Domain Number 1 Region: 15-100
Classification Level Classification E-value
Superfamily EF-hand 4.33e-18
Family Parvalbumin 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005613   Gene: ENSEEUG00000006188   Transcript: ENSEEUT00000006149
Sequence length 101
Comment pep:novel scaffold:HEDGEHOG:scaffold_251121:10319:14477:-1 gene:ENSEEUG00000006188 transcript:ENSEEUT00000006149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSITDLLSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDVFRFIDNDQSGYLD
EEELKFFLQKFESGARELTESETKSLMAAADNDGDGKIGAE
Download sequence
Identical sequences ENSEEUP00000005613 ENSEEUP00000005613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]