SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005625 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005625
Domain Number 1 Region: 175-296
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005625   Gene: ENSEEUG00000006172   Transcript: ENSEEUT00000006162
Sequence length 318
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8738:9275:33828:1 gene:ENSEEUG00000006172 transcript:ENSEEUT00000006162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSFGFASSLFSIIKDHVNRSEASPTMDFISVITKKSNSLSHFNLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTRFLDV
YLFLFDDFLLVTKTKRNKKKLGGSDPGLLCPSFSPELQTVIKEGGSCTVLDQPIPVDRLV
VRSIDPLHVSAFGLRHAFLIQHENRYRQCVAAFLLQAQTENIKTAWMAQLTAAISCFTKN
QEMKKVSLSTLPTESSQI
Download sequence
Identical sequences ENSEEUP00000005625 ENSEEUP00000005625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]