SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005658 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005658
Domain Number 1 Region: 154-309
Classification Level Classification E-value
Superfamily EF-hand 4.33e-28
Family Calmodulin-like 0.035
Further Details:      
 
Domain Number 2 Region: 45-180
Classification Level Classification E-value
Superfamily EF-hand 8.86e-19
Family Calmodulin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005658   Gene: ENSEEUG00000006226   Transcript: ENSEEUT00000006198
Sequence length 315
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3378:5254:59498:1 gene:ENSEEUG00000006226 transcript:ENSEEUT00000006198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRQFLLCLSLYTAFALSKPTEKKDRVHHEPQLSDKVHNDAQNFDYDHDAFLGAEEAKT
FDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWHEFDMNQ
DGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEF
RDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
QATDFGEALVRHDEF
Download sequence
Identical sequences A0A1S2ZY03
XP_007526365.1.11023 ENSEEUP00000005658 ENSEEUP00000005658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]