SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005713 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005713
Domain Number 1 Region: 188-293
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-36
Family Second domain of FERM 0.00000297
Further Details:      
 
Domain Number 2 Region: 357-434
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000307
Family Third domain of FERM 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005713
Domain Number - Region: 158-187
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00019
Family First domain of FERM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005713   Gene: ENSEEUG00000006223   Transcript: ENSEEUT00000006259
Sequence length 1084
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_963:6023:72303:-1 gene:ENSEEUG00000006223 transcript:ENSEEUT00000006259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKPEQESEPQEAVGAQGPAGTQPVSQERQQKGLEQFEAAAHSTPVRKEIT
DKEQEFAAGVAKQLEYQQLEDDKLSQKSYSSKLSRSPLKIVKKPKSMQCKVILLDGSEYT
CDVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNWLDPAKEIKKQIRSGAWHFS
FNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPD
ECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHA
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFEQFESTI
GFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRRASALI
DRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKAEEERDEEED
RRRKAEETTPVPAVRQEGKSPELGTDSCPVSPSAHCHPASPTELRRRCKENEQPPLGCEP
RKGVVHLHPEPALDSEGKGKKPYLGDQNVAFSYKPQAGRRTTMFSFSLQLPESFPSLLDD
DGYLSFPNLSETSLLPQSLQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSFPLAM
CLCYLEPKAASLSASLDSDPSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQELD
KAQDDLMKHQTNISELKRTFLETSTDTAIANEWEKRLSTSPVRLAARQEDAPMIEPLEPE
ETKQSSGEKLMDGSEIFSLLESARKPTEFIGGVTSTSQSWVQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXTVKGGISETREKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEIAPE
DAED
Download sequence
Identical sequences ENSEEUP00000005713 ENSEEUP00000005713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]