SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005745 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005745
Domain Number 1 Region: 6-407
Classification Level Classification E-value
Superfamily Ras GEF 5.89e-98
Family Ras GEF 0.00041
Further Details:      
 
Domain Number 2 Region: 412-475
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000105
Family Calmodulin-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005745
Domain Number - Region: 478-507
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00153
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005745   Gene: ENSEEUG00000006260   Transcript: ENSEEUT00000006293
Sequence length 508
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5299:4457:37624:1 gene:ENSEEUG00000006260 transcript:ENSEEUT00000006293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGLGKAATLDELLSTCIEMFDDNGELNNSYLPGIVPRMHRWYLSSTELAEKLLCIYL
FDENCNEFRLKVCYFMRYWILKFPAEFNLDLGLIRMTEEFQEAASQLGNEKHISLIDISS
IPYDWMRRVTQKVKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLD
NNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVG
GLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIPILGVHL
KDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVALQSAAHHLEPNMDLINLLTLSLGL
YHTEDDIYKLSLVLEPKNSKSQPTSPTTPTKPMAPLDWASGVMPKPDPTLINKHIRKLVE
SVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLH
CKMGPGFVHNFQEMTYLKPTFCEHCAGF
Download sequence
Identical sequences ENSEEUP00000005745 ENSEEUP00000005745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]