SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005760 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005760
Domain Number 1 Region: 549-632
Classification Level Classification E-value
Superfamily SH3-domain 4.13e-17
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 2 Region: 458-536
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000381
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 56-192
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000157
Family FCH domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005760   Gene: ENSEEUG00000006272   Transcript: ENSEEUT00000006309
Sequence length 694
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3557:244817:261921:-1 gene:ENSEEUG00000006272 transcript:ENSEEUT00000006309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKVKPVQEVKLRFLEQLSILQTRQQREADLLEDIXXXXXXXXXXXXXXXXALQKL
AGPFLKREGHRSGEMDSKGRMVFGAWRCLLDATVAGGQARLQASDRYRDLAGGTGRSAKE
QVLRKGAETLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQEKAADVQARLNRSDHGLF
HTRTSLQKLSVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVCALELEGGTGGVAGESGLEKEVQRWTSRAARDYKIKNHGCWVLQRLEQR
RQQTPEREIPGIEQRLQEVKENIRRAQVSQVKGAARLALLEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXAEDADLSDFEECEETGELFEEPAPVTLATKPLPCPAHVV
FGYQAVREDELTITEGEWLEVIEEGDADEWVKARNQHGEVGFVPEQYLNFPDLSSPETGC
DSDIPSGSEPTAFLARALYSYTAQSTEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGHV
GVFPSLLVEELLGPPGPLEFSDPEQTLPSPSPPSFSPPAPTSTLDGLPTPVLLAEQEVGC
PGPLDMMAPRLRPMRPPPPPPAKAPDPGHPDSLT
Download sequence
Identical sequences ENSEEUP00000005760 ENSEEUP00000005760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]