SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005769 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005769
Domain Number 1 Region: 125-511
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000797
Family Regulatory subunit H of the V-type ATPase 0.088
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005769
Domain Number - Region: 2-53
Classification Level Classification E-value
Superfamily PH domain-like 0.032
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005769   Gene: ENSEEUG00000006324   Transcript: ENSEEUT00000006321
Sequence length 660
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1416:6119:58125:-1 gene:ENSEEUG00000006324 transcript:ENSEEUT00000006321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVD
ITQDLVDESEEERFDDMSSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEG
YIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDP
ALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLST
LHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDESTDEEKRQELVNFLKEFCAFSQTLQPQ
NRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQND
DDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHC
MHVLTAPLLANTTEEKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVL
VLMASKHAFLALCALRFMRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAV
LEMFEFIRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMRS
ILRNHRYRRDARTLEDEEEMWFNTDEDDMDDGEAVVSPSDKCKNDDDIMDPISKFMERKK
Download sequence
Identical sequences ENSEEUP00000005769 ENSEEUP00000005769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]