SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005771 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005771
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily EF-hand 1.6e-19
Family S100 proteins 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005771   Gene: ENSEEUG00000006355   Transcript: ENSEEUT00000006323
Sequence length 88
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_274654:621:997:-1 gene:ENSEEUG00000006355 transcript:ENSEEUT00000006323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTNLEKAINNIIDIFHKYSLKTGNYHSLYRNDLKSLMESECSMYLKEKNADTWFTELDI
NSDQAINFEEFLILVIKIAVAAHGLHKE
Download sequence
Identical sequences ENSEEUP00000005771 ENSEEUP00000005771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]