SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005866 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005866
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.77e-45
Family FCH domain 0.011
Further Details:      
 
Domain Number 2 Region: 511-582
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-20
Family SH3-domain 0.00058
Further Details:      
 
Domain Number 3 Region: 415-487
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000223
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005866   Gene: ENSEEUG00000006398   Transcript: ENSEEUT00000006425
Sequence length 684
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6666:94805:282666:-1 gene:ENSEEUG00000006398 transcript:ENSEEUT00000006425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQKLASQYLKRDWPGIKTDDRNDYRSMYPVWKSFLEGTMQVAQSRINICENYKNFISEPA
RTVRSLKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSK
LSLFQSRISLQKASIKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYHTDLVNIMKA
LDGNVYDHLKDYLIAFSRTELETCQAVQNTFQFLLETSTKVVRDYNLQLFLQENAVFHKP
QPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLDDLECHG
AAVPEQSRADLEQKIDEARENIRKAEVIKLKAEARLDLLKQIGVSVDTWLKSAMNQVMEE
LDSERWARLPAVTNNGTSHPLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKV
VYSYKASQPDELTIDEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSM
LQSLAALDSRSHTSSNSTEAELFSGSLNGDASVCFVKALYDYEGQTDDELSFSEGAIIRI
LNKENQADDGFWEGDFNGRVGVFPSVLVEELSASENGDTPWIKDIQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRA
APPPPTQNHRRPADKLEDVEITLV
Download sequence
Identical sequences ENSEEUP00000005866 ENSEEUP00000005866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]