SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005915 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005915
Domain Number 1 Region: 137-430
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-88
Family Myotubularin-like phosphatases 0.00000718
Further Details:      
 
Domain Number 2 Region: 9-98
Classification Level Classification E-value
Superfamily PH domain-like 9.1e-18
Family GRAM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005915   Gene: ENSEEUG00000006474   Transcript: ENSEEUT00000006478
Sequence length 432
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8532:77331:103855:-1 gene:ENSEEUG00000006474 transcript:ENSEEUT00000006478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLQKFHFRNLLLGEHDVPLTCIEQIVTVNDHKRKQKVLGPNQKLKFNPTELIIYCKDFR
IVRFRFDESGPESAKKVCLAIAHYSQPTDLQLLFAFEYVGKKYHNTANGINGLPSGGGGG
GSSSAVGGGQGPQTPLFETYSDWDREIKRTGASGWRVCSINEGYMISTCLPEYFVVPSSL
ADQDLKNFSHSFVGRRMPLWCWSHANGSALVRMALIKDTLQQRKIDQRICNAVTKSHPQR
SDVYKSDLDKTLPNIQDIQAAFVKLKQLCINEPFEETEDKWLSSLENTRWLEYIRTFLKH
SAELVYVLESRRLSVVLQEEEGRDLSCVIASLVQVMADPYFRTITGFQSLIQKEWVMAGY
QFLDRCNHLKRSEKESPLFLLFLDATWQLLEQYPAAFEFSETYLAVLYDSTRISLFGTFL
FNSPHQRVKQST
Download sequence
Identical sequences ENSEEUP00000005915 ENSEEUP00000005915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]