SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006022 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006022
Domain Number 1 Region: 32-169
Classification Level Classification E-value
Superfamily PX domain 5.89e-17
Family PX domain 0.005
Further Details:      
 
Domain Number 2 Region: 203-401
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000165
Family BAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006022   Gene: ENSEEUG00000006594   Transcript: ENSEEUT00000006596
Sequence length 404
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1105:5189:20340:-1 gene:ENSEEUG00000006594 transcript:ENSEEUT00000006596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVPELLQEQEEDRSKMRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPIFQS
SEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFSGAKEVDDFFEQEKNFLINYYNRIKDSCGKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTAIKKYLLKVAELFEKLRKVESRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAETNQQECCQKFEQLSESAKEE
LINFKRKRVAAFRKNLIEMSELEIKHAKNNVSLLQSCIDLFKNN
Download sequence
Identical sequences A0A1S2ZWM1
XP_007525743.1.11023 XP_016044935.1.11023 ENSEEUP00000006022 ENSEEUP00000006022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]