SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006100 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006100
Domain Number 1 Region: 240-309
Classification Level Classification E-value
Superfamily SH2 domain 0.00000996
Family SH2 domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006100   Gene: ENSEEUG00000006672   Transcript: ENSEEUT00000006677
Sequence length 323
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5269:1061:20205:1 gene:ENSEEUG00000006672 transcript:ENSEEUT00000006677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLLHLPCAQHPFLKAQEEEEEEEEEEEDKYELPPSDVLHLSLAPAHFPGCEEDSVYMXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKVAEVSLQRSMKQGPSFGRPG
NEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGPSTV
RPSSEPGSQPLTLMVLLHGRFNIPIRQPCGGRHYALGREAKSHEELFSSVTAMVKHYAQH
PLPLLDRLQGGRRLTCLLFPTKP
Download sequence
Identical sequences ENSEEUP00000006100 ENSEEUP00000006100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]