SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006125 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006125
Domain Number 1 Region: 33-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 1644-1797
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-29
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 1855-2009
Classification Level Classification E-value
Superfamily Spectrin repeat 2.06e-26
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 1536-1665
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-23
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 429-530
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 7 Region: 819-952
Classification Level Classification E-value
Superfamily Spectrin repeat 4.85e-22
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 8 Region: 1261-1379
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-18
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 9 Region: 1981-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-16
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 10 Region: 499-601
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000366
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 11 Region: 2204-2262
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000224
Family Pleckstrin-homology domain (PH domain) 0.00031
Further Details:      
 
Domain Number 12 Region: 1390-1486
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000209
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006125   Gene: ENSEEUG00000006597   Transcript: ENSEEUT00000006708
Sequence length 2262
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3310:104887:208859:-1 gene:ENSEEUG00000006597 transcript:ENSEEUT00000006708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPADMTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQ
KKTFTKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENV
DKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAK
DALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEH
AFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDH
AIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKF
QEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIR
QEKLEQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEE
RVRALEDLAQELEKENYHDQKRITARKDNILRLWNYLQELLRARRQRLETTLALQKLFQD
MLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTE
EKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
ATRALEKKHKDFLEELEESRAVMEHLEQQARDFPQEFRDSPDVTNRLQTLRELYQQVVAQ
ADLRRQRLQDALDLYTVFGETDACELWMGEKEKWLAQMDIPDTLEDLEVVQHRFDILDQE
MKTVMAQIEGVNQAANSLVESGHPRRGEVEPVPDHLNPRGKAFQAMLQRGRKAVDSALRV
HNYCVHCEETARWITDKTRGVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY
RKNDEKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLMSQDVSYDEARNLHNKWLKHQ
AFVAELASHQEWLENIDAEGKQLMEEKPQFAAQVSQRLEALHRLWDELQATTQEKAKHLS
AARSSDLRSQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKALEDQVNVRKEELG
ELFAELPSVGEEAGDTDLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEE
RLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQQLVETAEIDCQDID
EHLGQLRGSWDTLRKAAAARLQRLRDASEAQQYYLDAGEAEAWISEQELYVISDETPKDE
EGAIVMLKRHLRQQRSVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLK
DMAEERKRKLENMYHMFQLKREADDLEQWIAEKELVASSPEMGQDFDHVTLLRDKFRDFA
RETGSIGQDRVDNVNTIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAAS
YDLHRYFYTGTEILGLIDEKHRELPEDVGLDANTAESFHRVHTAFERELHLLGVQVQQFQ
DVATRLQTAYAGEKADDILNKEREVSAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLL
SWMESIIRQIETQERPRDVSSVELLMKYHQGIRAEIETRSKNFSACLELGESLLQRQHQA
SEEISEKLRQVVSRRKEMNEKWEARWDRLRMLLEVCQFSRDASVAEAWLIAQEPYLASRD
FGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPLEETGPQEEEG
ETAGEAPRPHRAATERTSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSWNNLYCVLRNSQLT
FYKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKL
Download sequence
Identical sequences ENSEEUP00000006125 ENSEEUP00000006125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]