SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006167 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006167
Domain Number 1 Region: 21-163
Classification Level Classification E-value
Superfamily EF-hand 5.31e-43
Family Calmodulin-like 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006167   Gene: ENSEEUG00000006775   Transcript: ENSEEUT00000006750
Sequence length 166
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5334:1029:25581:-1 gene:ENSEEUG00000006775 transcript:ENSEEUT00000006750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLALRGELVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDV
KKADVLKILKDYDREATGKITFDDFNEVVTDWILDRDPHEEILKAFKLFDDDDSGKISLR
NLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI
Download sequence
Identical sequences A0A1S2ZGI2
XP_007519029.1.11023 ENSEEUP00000006167 ENSEEUP00000006167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]