SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006207 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006207
Domain Number 1 Region: 1708-1896
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000691
Further Details:      
 
Domain Number 2 Region: 1-159
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-40
Family Motor proteins 0.00011
Further Details:      
 
Domain Number 3 Region: 592-720
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.59e-24
Family Motor proteins 0.0017
Further Details:      
 
Domain Number 4 Region: 1628-1701
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000239
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006207   Gene: ENSEEUG00000006680   Transcript: ENSEEUT00000006793
Sequence length 2199
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_598:1072:77054:-1 gene:ENSEEUG00000006680 transcript:ENSEEUT00000006793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYVEKYLLEKCRLVYQEHNERNYHVFYYLLAGASEEERLAFHLKPPEEYHYLNQDCFTVE
GEDLKHDFERLQLAMEMVGFLPKTRRQIFSLLSAILHLGNISYKRKAYRDDSIGICNPEV
LPVVSELLEVKEEMLLEALVTRKTVAVGEKLILPYKLAEXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHDDTAPCAILKNVDSFSFLQHPV
HQRSLEILQRCKEEKYSITRKNPRTPLSDLQGMNALNEKSQHDTFDVTWNGRAGVRQNRL
SSSTPLLEKDGIFSNSTSSKLLERAHGILTRSKNFKSKPGLPKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPLRFSDAV
VLRQLRYTGMLETVRIRQSGYSCKYSFQDFASHFHVLLPRNITPSKFNIQDFFRKINLNP
DNYQVGKSMVFLKERERQHLQDLLHREVLRRIALLQRGVRALQCRQRFLHLRQAAVTIQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXFFYIPHQDPLFTAPHLDAGLQRSGQPEGRGTALPLGAGRGARKHRCPGRLSA
TPVKTDPADAVLQKLEKLSSEKEQRQKQLQQQNEKEMMGQVRRQMGVLEKERRALRTVER
PRTGEPVLTPSVRPSKQSGDGAPALPAPASPRKVESGVPAPPSAPGRDAALAPRDGPSAH
SAPRSRPVTLFLDRKGGLGQLSIAKEPPRTEKTRSHASAASQHQSDGAPKRERWRPPRAS
GHKLDEPPGGGAASAIFFTPQGGVNASVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XISQRFSSVDEELKLHKTLSQGEITKSSSVRQKASDLDTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQSQPSPPLSPELPGSSQKESKENREPSPKG
KCRGGAGGGSVALEGVHSQSDSVRILESGGDLKSMDEFLLEKMNDLDNEDSKKDTLVDVV
FKKALREFRQNIFSFYSSALATDDGKSIRYKDLYALFEQILEKSMRLEQRDWSEPPVRVW
VNTFKVFLDEYLSRSKTMDHVATKVEEHNGHVFKATQYSIPTYCEHCSSLIWIMDRASVC
KLCKYACHKKCCLRTTVKCSKKYDPELSSRQFGVELSRLTSEDRTVPLVVEKLINYIEMH
GLYTEGIYRKSGSTNKIKELRQGLDTDVENVSLDDYNIHVIASVFKQWLRDLPNPLMTFE
LYEEFLRAMGLQERKETVRGVYSVIDQLSRTYLNTLERLIFHLVRIALQEDTNRMSANAL
AIVFAPCILRCPDTTDPLQSVQDISKTTTCVELIIVEQMAKYKARLKDISSLEFAESKAK
SRLSLIRRSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXEELTFEMLVLEPRASDDETLESEASIGTADSSENLNVEHEGT
VLEKSERSLAPHRVLRVGGKLEPSGRSQKHLSRPPDSVDSGGSAAFSFCPSNSGSSHGIR
KRFQIHSKSPFYRAASAETPGEKEPLSQTGCLEERPQFISRGTFNPERGKQKLKSVIHSP
QKTKETPEGTVVSARRKPVDPDHSSPPQLAVFSNNEFMV
Download sequence
Identical sequences ENSEEUP00000006207 ENSEEUP00000006207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]