SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006217 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006217
Domain Number 1 Region: 513-679
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000087
Family SPRY domain 0.029
Further Details:      
 
Domain Number 2 Region: 45-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000019
Family SPRY domain 0.074
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000006217
Domain Number - Region: 719-878
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0053
Family SPRY domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006217   Gene: ENSEEUG00000006738   Transcript: ENSEEUT00000006806
Sequence length 1556
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3630:6574:24993:-1 gene:ENSEEUG00000006738 transcript:ENSEEUT00000006806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEMAAGSGGNGGSGGGPGPGGGGGGGPGPSGGLGSGGELHPRTGRLVSLSACGRTARRQQ
PGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPGALDFPSSATGLKG
GSWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTAAGELRLWVNGRDCGVAAAGL
PARVWAVVDLYGKCTQITVLPSEPGCGPPAPVPAAPLEPAAPPEDSAAAEPGTSGDEAFM
VSPVQPRPETFPNSLESHNDFSGMELSEVVSNAILSAYNGGLLNVNLSSPPAGEGLGPIG
AATSPVLTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVVMTNRPLRDNEMFEI
RIDKLVDKWSGSIEIGVTTHNPNNLEYPATMTNLQSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVKVTIVHNN
NHSDRLRRNNAILRALSPEGALRRSAPVTQAEPERLLFHPNCGQKAAITHEGRTALRPHA
TDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPSTMTNLRSG
TWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQGPAAWNVP
PGVYAVVDLYGQAAQATIVDDVEVPPIPEPLPEGNNQVSPSSPSSGAGGSDLRFHQLHGS
NAVITNGGRTALRHNCRSEFNDAIVISSRALRDGELFEIVIQKMVDRWSGSIEAGVTAIR
PEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMRTAKGDLH
YFINGQDQGAACSGLPPGKEVYAVVDLYGQCVQVSITSATGPMDNSLATSNTATEKSFPL
HSPVAGVAHRFHGTCGKNITLEEDGTRAVRATGYAHGLVFSTKELKTEEVFEVKVEELDE
KWAGSLRLGLTTLAPGEMGPGIGGGPGLPPSLPELRTKTTWMVSNCEVRRDGQLQRMNYG
RNLERLGVGSRVGIRRGADDTMHILVDGEDMGPAATGIAKNVWAVLDLYGPVRSVSVVSS
TRLEEPEGTQPPSPSSDIGSEGEEDDEGEEHGLGGQNQMAIVPTALEFLENHGKNILLSN
GNRTATRVASYNQGIVVISQPLVPQLLVQVRIDFLNRQWTSSLVLGIITCPPERLNFPAS
ACALKRAAWLLRGHGVFHNGLKICEKFGPNLDTCPEGTILGLRLDSSGGLHLHINGLDQG
VAVPDVPQPCHALVDLYGQCEQVTIVSPEPGATSGKSVGTQGDMEKADMVDGIKESVCWG
PSPTTSPLKSCEYHALCSRFQDLLLLPEDYFMPPPKRSLCYCESCRKLRGDEAHRRRGEP
PREYALPFGWCRFNLRVNPRLEAGTLTKKWHVAYHGSNVAAVRRVLDRGELGAGSASILS
CRPLKGEPGVGFEEPGENCAPPREEQPPPVLLSPSLQYAGAETLASKVQFRDPKSQRTHQ
AQVAFQVCVRPGSYTPGPPSAALREPPDPHFSPAELEWVTKEKGATLLYALLVRVE
Download sequence
Identical sequences ENSEEUP00000006217 ENSEEUP00000006217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]