SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006232 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006232
Domain Number 1 Region: 1015-1084
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000599
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number 2 Region: 1095-1138
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000143
Family SAM (sterile alpha motif) domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006232   Gene: ENSEEUG00000006740   Transcript: ENSEEUT00000006822
Sequence length 1256
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4335:8148:244174:-1 gene:ENSEEUG00000006740 transcript:ENSEEUT00000006822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMYEVISMIKEDTPMSQRETQSSGLDSDSQFEQLMVNMPDERDGLLDIVEIQENLLLAQQ
RHQDVICGDLLQRQLSSALPQDIESLGGLTGSKGTDPPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVRERLRVSLERVSALEEELAAANQEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXRLSNGSIDSTEDTSQILELQELLEKQNYEMAQMKERLAALSSRVGEVEQ
EAETARKDLIKTEEMNTKYQRDIREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
EERHGNIEERMRHLEGQLEEKNQELQRARQREKMNEEHNKRLSDTVDRLLTESNERLQLH
LKERMAALEEKNVLIQESETFRKNLEESLHDKERLAEEIEKLRTELDQMKIRTGALIEPT
ISRTHLDTSTELRYSMGSLVESQSDYRTTKVIRRPRRGRMGVRREEPKVKSLGDHEWNRT
QQMGVLGTHPFESDTEMSDIDDDDRETIFSSMDLLSPGGHSDAQTLAMMLQEQLDAINKE
IRLIQEEKESTELRAEEIENRVASVSLEGLNLARVHPGTSITASVTASSLASSSPPSGHS
TPKLTPRSPAREMDRMGVMTLPSDLRKHRRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHELLEEARRKGLPFAQWDGPTV
VAWLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKESEEGSWAQCPLFLQTLAYGDMNHEW
IGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRVHLKMVDSFHRTSLQYGIMCLKR
LNYDRKELERRREASQHEIKDVLVWSNDRVIRWIQAIGLRDYANNILESGVHGSLIALDE
NFDYSSLALLLQIPTQNTQVDARQILEREYNNLLALGTERRLDESDDKNFRRGSTWRRQF
PPREVHGISMMPGSSETLPAGFRLTTTSGHSRKMPTDVASSRLQRLDNSTVRTYSC
Download sequence
Identical sequences ENSEEUP00000006232 ENSEEUP00000006232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]