SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006254 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006254
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily EF-hand 2.59e-18
Family S100 proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006254   Gene: ENSEEUG00000006881   Transcript: ENSEEUT00000006850
Sequence length 103
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_203350:2663:3282:1 gene:ENSEEUG00000006881 transcript:ENSEEUT00000006850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADCYTDLEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLKNELNHMLTDTGNRKAAD
KLIQNLDANHDGRISFDEYWTMIGGIMAPIANLIRQQEQQCNS
Download sequence
Identical sequences A0A1S2ZVY5
ENSEEUP00000006254 ENSEEUP00000006254 XP_007525450.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]