SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006256 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006256
Domain Number 1 Region: 445-608
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.44e-64
Family A middle domain of Talin 1 0.000000409
Further Details:      
 
Domain Number 2 Region: 708-843
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.2e-52
Family I/LWEQ domain 0.00000191
Further Details:      
 
Domain Number 3 Region: 613-737
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.94e-52
Family I/LWEQ domain 0.000004
Further Details:      
 
Domain Number 4 Region: 1794-1928
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.67e-28
Family VBS domain 0.0001
Further Details:      
 
Domain Number 5 Region: 266-356
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-24
Family Third domain of FERM 0.0000181
Further Details:      
 
Domain Number 6 Region: 2250-2332
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000019
Family I/LWEQ domain 0.0035
Further Details:      
 
Domain Number 7 Region: 1426-1511
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000115
Family I/LWEQ domain 0.016
Further Details:      
 
Domain Number 8 Region: 216-265
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000262
Family Second domain of FERM 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000006256
Domain Number - Region: 1678-1770
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000643
Family alpha-catenin/vinculin 0.075
Further Details:      
 
Domain Number - Region: 35-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00155
Family First domain of FERM 0.082
Further Details:      
 
Domain Number - Region: 1960-2031
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0361
Family VBS domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006256   Gene: ENSEEUG00000006679   Transcript: ENSEEUT00000006853
Sequence length 2414
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7042:1607:275894:1 gene:ENSEEUG00000006679 transcript:ENSEEUT00000006853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDYGLFLSDEDPRKGIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDD
SKTVGELLVTICSRIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKEFLPKEYIKQRGAEKRVFQEH
KNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDER
TKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKK
QSKDRFGLEGDEESTMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETF
NVGSMPSPQQQVLVGQMHRGHMPPLTSAQQALMGTINTSMHAQQAQDDLGELDSLPPLQD
MASRVWVQNKVDESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLT
EMSKGVKLLAALMDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIG
QASGDLLRQMGENETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAA
ATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDGEVLK
QVGAAASVVSQALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQ
ARVLAQATSDLVNAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPAKED
QQQMLREAAEGLRVATNAAAQNAIKKKIVNRLEVAARQAAAAATQTIAASQNAAVTNKNA
AAQQQLVQSCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVTESINQLITLCTQQAPGQKECD
NALRELETVKGMLDNPNEPVRELSYFDCSESVMENSKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDP
GSSPSQXXXXXTIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIK
ALDGDFSEDNRNKCRIATAPLIEAVENLTAFASNPEFVSVPAQISNEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKAPGQRECDYS
IDGINRCIRDIEQASLGAVSQSLATRDDISVEXXXXXXXXXXXXXXXXXXXXXXXXXGEA
AQLGHKVTQLASYFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGG
NPKAQHTHDAIMEAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPE
PKGTFVDYQTTVVKYSKAIAVTAQEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXISFQIRTRVQDLGHGCIFLVQKAGALQVCPSDSYTKQELFQCARAVTEKVSLVL
SALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAENNESFADHRENILKTAKA
LVEDTKLLVSGAASTPDKLAQAAQSSDATITQLAEVVKLGAASLGSDDPETQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXPEWVDPEDPTVMAEAELMGAAASIEAVAKKLEQ
LKPRAIPKQADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIAAQEEMLKKERELEEARKKLAQIRQQ
QYKFLPTELREDEG
Download sequence
Identical sequences ENSEEUP00000006256 ENSEEUP00000006256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]