SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006378 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006378
Domain Number 1 Region: 516-649
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-26
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Domain Number 2 Region: 368-454
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-17
Family Sec7 domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006378   Gene: ENSEEUG00000006987   Transcript: ENSEEUT00000006990
Sequence length 774
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4850:13574:56645:1 gene:ENSEEUG00000006987 transcript:ENSEEUT00000006990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEKIPSAQPGDSDATWEPNVEPEEEPGIQNGMSASEELKNSHSSPGHVMRVTLLDSEE
PTKGSDLALHGLSLGLPLTNGLTLQPDSNILDDSTECRSWRASTLAEDKDASRSLCPDSE
DPQLGLSDPCEPDVRDGFSTTFEKIVESELLRGTQYSSLDSLDVLSLTDESDSCVSFEAP
LTPLIQQRARDSPEPGTTLGIGDMGLEGGLGAAGGDGELGSPLRRSISSSRSENVLSRLS
LSSVPNGLHEDGLQGPGGDEEEEEEEDTDKLLNSVSDPSLKDGLSDSDSEMSSSEGLEPS
IDPLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEXXXXXXXXXXXXXXXX
XXXXNIGKKMSCQQFIANLDQLNDGQDFSKDLLKXXXXXXXXXXXXXXXDEDELRKSLSE
LVDDKFGAGTKKVTRILDGGNPFLDVPQALSAATYKHGVLTRKTHADMDGKRTPRGRRGW
KKFYAVLKGTILYLQKDEYRPDKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTAD
WRVFLFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQ
LRSHENKLRQVTAELAEHRCHPVERGIKSKEAEESRLKEHYLTFEKSRYETYIHLLAVKI
KVGSDDLERIEARLATLEGDDPSLRKTHSSPALSQGHGTVTGSKATKDATGPDT
Download sequence
Identical sequences ENSEEUP00000006378 ENSEEUP00000006378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]