SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006413 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006413
Domain Number 1 Region: 120-307
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-35
Family BAR domain 0.011
Further Details:      
 
Domain Number 2 Region: 449-529
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-18
Family SH3-domain 0.00069
Further Details:      
 
Domain Number 3 Region: 10-77
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-16
Family DBL homology domain (DH-domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006413   Gene: ENSEEUG00000007041   Transcript: ENSEEUT00000007025
Sequence length 532
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7747:1442:26275:1 gene:ENSEEUG00000007041 transcript:ENSEEUT00000007025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDLTPVFSFRPQAGPSGLSFLLVIPLQRITKYPLLLQKILENTLPADSAYPTIQRAASAL
QDVTTNINEYKRRKELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
TEDKEFDDLEERFHLVSLCVTELKSNVAAYLDNLEAFLRFRPQDCDLDMAEGPVVQYRSL
TQDLHLQAFPEFKQRLEGLVWKPLCNLARALVGPQNLIKKRLDKLLDFERVEEKLLEVGS
VTYEEEAARHTYQALNSLLVAELPQFNQLAVQWLGQILRTFMALQRDLAQQVLQRAEGSL
AQLPHSQVSEPAFKKLVEETLGQNGNQLQSFQENFGKVLPPPTIQPLLPGAERQVEALLS
RHGPGKLYQVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRGYVPAGR
LERYHVAPREEGLGGYKGSCDDTQCLMPEPTPAPASTLPTITQVVAVYPFVARSSHEVGV
QAGQAVTILEAHDKKGNPEWSLVDVNGQRGYVPSSFLARPPSPAPWGWNLPS
Download sequence
Identical sequences ENSEEUP00000006413 ENSEEUP00000006413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]