SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006480 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006480
Domain Number 1 Region: 614-735
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.98e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 2 Region: 55-200
Classification Level Classification E-value
Superfamily PH domain-like 4.18e-26
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000006480
Domain Number - Region: 480-520
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.000126
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006480   Gene: ENSEEUG00000007045   Transcript: ENSEEUT00000007096
Sequence length 956
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_172:4737:74121:1 gene:ENSEEUG00000007045 transcript:ENSEEUT00000007096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDQPRDKELVERSQLDCVGDGPLSNQLSASSTINPVPLVGLQKPEMSLPVKSGQGDSEG
SSPFTPATDEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRSQWQISLDVTLSVPNVS
EGTVRLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNAELFRIHVFRCEI
QEAVSRILYSFATAFRRSAKQTPLSAMAAPQTPDSDIFTFSVSLEIKEDDGKGYFSASSQ
DKDRQCFKLRQGIDKIVIYVQQTTNKELAIERCFGLLLSPGKDVRNSDMHLLDLESMGKS
SDGKSYVITGSWNPKSPHFQIVNEETPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXNDEPLLSGSGDVSRECAEKVLETWGGLLVKWHLNLS
VRPKQLSSLVRSGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAAVMLLHMPEEQAFSVLVK
IMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFT
AKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRS
EENAKKLMELACNMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAEEKADALNKELLMTKQKLIDAEEEKRRLEEESAQXX
XXXXXXXXXXXXXXXXXXXXIGDYKQICSQLSERLEKQQTANKVEIEKIRQKVDDCERCR
EFFNKEGRIKSISSAKDVLDEDTDEEKETLKNQLREMELELAQTKLQLVEAECKIQ
Download sequence
Identical sequences ENSEEUP00000006480 ENSEEUP00000006480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]