SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006484 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006484
Domain Number 1 Region: 31-138
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.53e-27
Family BAR domain 0.00019
Further Details:      
 
Domain Number 2 Region: 202-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000000471
Family BAR domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000006484
Domain Number - Region: 518-552
Classification Level Classification E-value
Superfamily SH3-domain 0.000106
Family SH3-domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006484   Gene: ENSEEUG00000007069   Transcript: ENSEEUT00000007101
Sequence length 556
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4045:66:28648:-1 gene:ENSEEUG00000007069 transcript:ENSEEUT00000007101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTR
LQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWLDYHQKLVD
QALLTMDTYLGQFPDIKXXXXXXXXXXXXXXXXXXXXXXLPTAKKKEVKLPKPVSLLEKA
APQWCQGKLQAHLVAQTNLLRNQAEEELVKAQKVFEEMNVDLQEELPSLWNSRVGFYVNT
FQSIAGLEENFHKEMSKLNQNLNDVLVSLEKQHGSNTFTVKAQPXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXFEAPGPFSEQASLLDLDFDPLPPVASPVKVPTPSGQSIPWDLWE
STESPAGSLPSGEPSAAEGTFAVAWPNQMAELGPAQPTEASEAAGGTQPAAGAQEPVETA
AGEAASSSLPAVVVETFSATVNGTVEASGRAGRLDLPPGFMFKVQAQHYTATDTDELQLK
AGDVVLVIPFQNPEEQ
Download sequence
Identical sequences ENSEEUP00000006484 ENSEEUP00000006484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]