SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006488 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006488
Domain Number 1 Region: 5-146
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-46
Family Pleckstrin-homology domain (PH domain) 0.0000269
Further Details:      
 
Domain Number 2 Region: 352-490
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.97e-35
Family Protein kinases, catalytic subunit 0.00000453
Further Details:      
 
Domain Number 3 Region: 215-346
Classification Level Classification E-value
Superfamily SH2 domain 1.28e-29
Family SH2 domain 0.0000301
Further Details:      
 
Domain Number 4 Region: 162-235
Classification Level Classification E-value
Superfamily SH3-domain 4.49e-17
Family SH3-domain 0.0000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006488   Gene: ENSEEUG00000007089   Transcript: ENSEEUT00000007108
Sequence length 631
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_779:73416:114173:-1 gene:ENSEEUG00000007089 transcript:ENSEEUT00000007108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSVLTYYEGRAEKKYRKGFIDVAKIK
CVEVVKNDDGVIPCQNKYPFQVVYDANTLYIFAPSAQSRDQWVKKLKEEIKNNNNIMIKY
HPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKVLPPAPEPKKRRPPPPIPPEEEDNS
EEIVVAMYDFQATEAHDLRLERGQEYIILEKNDVHWWRARDKYGSEGYIPSNYVTGKKLS
NLDQYDWYCRNTNRSKAEQLLRSEDKEGGFMVRDSSQPGMYTVSLYTKFGGESSSGFRHY
HIKETTTSPKKYYLAEKHAFSSIAELIEYHKHNAAGLVTRLRYPVSAKGKNAPTTAGFSY
EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYL
ERNSFIHRDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXKPEGRPSFEELLRTIDELVECEETFGR
Download sequence
Identical sequences ENSEEUP00000006488 ENSEEUP00000006488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]