SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006495 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006495
Domain Number 1 Region: 248-415
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-44
Family SPRY domain 0.00073
Further Details:      
 
Domain Number 2 Region: 16-93
Classification Level Classification E-value
Superfamily RING/U-box 1.97e-16
Family RING finger domain, C3HC4 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006495   Gene: ENSEEUG00000007134   Transcript: ENSEEUT00000007116
Sequence length 427
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3313:11539:96137:1 gene:ENSEEUG00000007134 transcript:ENSEEUT00000007116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLDTSPTVPVWLAEDDLGCIICHGLLAWPTTLPCGHSFCRDCLKGMWEARGKGGAGRG
WACPTCRKGGPQSLELQKTKILQDLVDKYSRVVSELGAGSPRPEPRHPPSTGTAAPRRQQ
SVAAQKSITEVDRELTELVGQLVGIAKSLQSERQPPESGPDNELSILDMAFSDGVNLSST
VKLTTSNTTERKIKDILHSLEGIQEKLQKNFTWKKPTEEQVQVELPEAPSLSGLLPVQNH
AIPKKASRFTQCTISPTFDRESLSCSLEMSEDCRTVTVSKFLQNYHWNPKRFTHCQVLCS
QALSSGQQYWEVDTQHCNHWAVGVASGGMGRNHMLGRTSDSWCIEWNETSELSVWHEIKK
TVLDSERPKVVGIWLSFEEGKLAFYSVADQKKHLFECRISVTSPLHPAFWLYGLHPGNAL
TIRPAKV
Download sequence
Identical sequences ENSEEUP00000006495 ENSEEUP00000006495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]