SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006526 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006526
Domain Number 1 Region: 273-381
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-25
Family SH2 domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 385-425
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000536
Family SOCS box-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006526   Gene: ENSEEUG00000007188   Transcript: ENSEEUT00000007149
Sequence length 438
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_266298:3962:5275:-1 gene:ENSEEUG00000007188 transcript:ENSEEUT00000007149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESNSENVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAEAVNAIDKTEVSLR
SQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKRKIH
ISELMLDKCPFPPRSDLAFRWHFIKQHTAPISPRSDDWGSTDLSQSDLRDGQLQQRENME
EDVSCFSHANAQPCVINTNSASCRGGSVANSVMNLVSSNSMEDSDTDSDDEIITLCTSSR
KRNKLKWEMDEEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALLEG
KPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLE
HYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPVPPSMKLYLKEY
HYKSKVRVLRIDAPEQCQ
Download sequence
Identical sequences ENSEEUP00000006526 ENSEEUP00000006526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]