SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006576 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006576
Domain Number 1 Region: 216-342
Classification Level Classification E-value
Superfamily PX domain 2.09e-25
Family PX domain 0.0018
Further Details:      
 
Domain Number 2 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000473
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000006576
Domain Number - Region: 365-572
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000497
Family BAR domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006576   Gene: ENSEEUG00000007225   Transcript: ENSEEUT00000007205
Sequence length 574
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7183:726:8017:1 gene:ENSEEUG00000007225 transcript:ENSEEUT00000007205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKGRALYDFHSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIIR
SGLGCGSSPSDYFSSSSEVPLGTQVSTYEDPGPGAGGSGFLSYQGSLEEDDDDDWDDWED
GCTVVDEPRAGGLGLSTNGHPPLNLSYPGAYPSQHVAFRPKPPLERQDSLALAKRGSVVG
RNLNRFSCFVRSGVEAFILGDVPMMAKIAETYSIEMGPQGPQWKANPHPFACSVEDPTRQ
TKFKGIKSYISYKLTPTHAGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEE
DFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLL
TFQIPTEHQDLQDVEDRVDAFKAFSKKMDDSVLQLSTVAAELVRKHAGGFRKEFQKLGSA
FQAVSHAFQLDPPFSNEALNSAISHTGRTYEAVGEMFAEQPKNDLFQMLDTLSLYQGLLS
NFPDIIHLQKGAFAKVKESQRMSDEGRMAQDEADGIRRRCRVVGFALQAEMNHFHQRREL
DFKHMMQSYLRQQILFFQRVSQQLEKTLRMYDSL
Download sequence
Identical sequences A0A1S3WEV1
ENSEEUP00000006576 ENSEEUP00000006576 XP_007525820.1.11023 XP_016044913.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]