SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006594 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006594
Domain Number 1 Region: 1547-1688
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-48
Family Phosphotyrosine-binding domain (PTB) 0.000000425
Further Details:      
 
Domain Number 2 Region: 1416-1536
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-22
Family SH2 domain 0.002
Further Details:      
 
Domain Number 3 Region: 13-155
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.00000000000276
Family Dual specificity phosphatase-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006594   Gene: ENSEEUG00000007106   Transcript: ENSEEUT00000007225
Sequence length 1694
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_897:4907:112502:-1 gene:ENSEEUG00000007106 transcript:ENSEEUT00000007225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSPPVEDSCELDLVYVTERIIAVSFSSSANEDTFRSNLRQVAQMLSSKHGGSYLLFNL
SERRPDITKLHAKVLEFGWPDLHTPALEICSVCKAMXXXXXXXXXXXXXXXXXGNRGRIG
VVIAAYMHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRFPEYGKVE
FVFSYGPEKIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVGHTQPLD
GSLYAKVKKKDSLQGSGGVHIQRPVLSATPNHVEHTLSVSSDSGNSTASTKTDKTDEPVS
GPASAPVVALSPEEKQELDRLLSGFGLEHGKQGTMYRCLTPSPGAAPPPGHHVVPAQVHV
NGGAASERETDILDDELPNQDGHSVGSMGTLSSLDGVANLSEGGYPEALSPMTNGVDKPY
AVECMVNGGGYAYEPAGGGPPVGAPMRPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVQRGLSSWQLHQQQQQQPLPPPRQQDRAPT
ESAPEFPRAASQQEIEQSIETLNMLMLDLEPISGGAPLHKSQSLPGAWPGASSLSAQPLP
GTAHPLTQSRSGYIPSGHALGAPELAPANRPYSPYDYQHCPAGPTQSLHPKSPATASSTS
PAFLPATHSPPGPQQPPASIPGLTAQPQLPPKEGTPDPSRTPEEEPLNLEGLVAHRVAGQ
ARERQPAEPPAPLRKRAASDGQYEYHSPEPSSPRSPGVRSPVQCVSPELALTIALNPGGR
PKEXXXXXXXXXXXXXXXXXXXXXXXXXXRSPPGLAKTPLSALGLKPHNPADIVLYSMGX
XXXXXXXXEDEGKVVMELPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTSMGSFPSGESSSQGHWTPTQPYMDPSFRSGSL
GQPSPSAQRNYQSSSPLPATGSSGAYSSPDYAFQPFSTPDGQARPPFSSAGVHPVPGSPQ
ARHRTVGTNTPPSPGFGRRALNSGMATPGSPGLSHHQVMGPGAGFHGNVVSSPQSSTVTT
PGSPGLARHPGVHQSSGLHGSNLVATPGSPNLGRHPGVHQGSLASGLHGSTTPSPGSPSL
GRHLGASGTVVPGSPSLDRHTAYGGHSTPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQ
EPGAFIIRDSHSFRGAYGLAMKVSSPPTTIMQQNKKGDMTHELVRHFLIETGPRGVKLKG
CPNEPNFGSLSALVYQHSIIPLALPCKLVIPNRDPTDDAKDSSGPANSTTDLLKQGAACN
VLFVNSVDMESLTGPQAISKATSETLAADPTPAATIVHFKVSAQGITLTNQRKLFFRRHY
PLNTVTFCDLDPQERKWMKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIV
NFVSKVMLSAGQKR
Download sequence
Identical sequences ENSEEUP00000006594 ENSEEUP00000006594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]