SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006684 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006684
Domain Number 1 Region: 325-436
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-21
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006684   Gene: ENSEEUG00000007293   Transcript: ENSEEUT00000007325
Sequence length 452
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_22:65693:156831:-1 gene:ENSEEUG00000007293 transcript:ENSEEUT00000007325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLNKITVPASQKLRQLQKMVHDIKNNDGGIMNKIKKLKIKAPPSVPQRDYAPESPADE
EEQWSDDFDSDYENPDEHSDSEMYVLPAEEQRDDSYEPPPAEQEPRIVHPALPFSRGEYV
DNRSSQRQSPPFSKTLPSKPSWPSAKSRLVSTMPASTSLQKPQVPPKPKELLEDEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXPMVNRSTKPPNSSKQVCLPGTVAGRNSGTWDSKSPSS
PAAPCPLPRAGKKTATPLQTIPVASQQNAPSVCEEKPIPAERHRGSSHRQEAVQSSMFPP
AYKQSHQKPIPLPRFPEGGNPVPVDGPLGLSEQEADIHCKPWYAGACDRKSAEEALYRSN
KDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAE
IIRNHQHSPLVLIDSQNNTKDSTRLKYAVRVS
Download sequence
Identical sequences ENSEEUP00000006684 ENSEEUP00000006684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]