SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006685 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006685
Domain Number 1 Region: 359-524
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-56
Family Phosphotyrosine-binding domain (PTB) 0.000000223
Further Details:      
 
Domain Number 2 Region: 538-661
Classification Level Classification E-value
Superfamily PDZ domain-like 8.54e-19
Family PDZ domain 0.0000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006685   Gene: ENSEEUG00000007320   Transcript: ENSEEUT00000007326
Sequence length 744
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_305:398:48307:1 gene:ENSEEUG00000007320 transcript:ENSEEUT00000007326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHRKRQSTASSMLDHRPRPGPGPHGQESESEDAGLPLEEYVPPGMELAALHPESPPPPT
EQSCHDHSPDGDSSSDYVNNTSEEDDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGE
GCLAHGGHPLETDECQEAVEEWTDSAGPHGDQGSPDYPDHLPLPEDEASVLXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTKA
RTPEERPKWLEQVCNGLEQPRKQQRSDLNGPIDNNNIPETKKVASFPSFVAVPGPCEPED
LIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSEGDSQT
LTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIE
TTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSD
IINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNSGP
AARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRP
DLKYQLGFSVQNGIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XIHMKTMPAAMFRLLTGQETPLYI
Download sequence
Identical sequences ENSEEUP00000006685 ENSEEUP00000006685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]